PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_46380.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 135aa    MW: 15554.3 Da    PI: 8.2623
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_46380.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.9e-132577557
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                             +r rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++  ++l++ ++  +
  Rsa1.0_46380.1_g00001.1 25 RRKRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQILDKLNKASDSND 77
                             699************************************99988887776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-112185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2542371IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-102476No hitNo description
PfamPF001703.9E-112582IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-122574No hitNo description
CDDcd147026.32E-162673No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
LQSPTSHNST TSDEATEETF VINERRKRRM VSNRESARRS RMRKQRHLDE LLSQVAWLRS  60
ENHQILDKLN KASDSNDLVL QENLTLKEEN LELRQVITSM KKLGGAEGGR TSLHGRYCSS  120
SLDHDLDQDF SCITK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13744RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325540.0AC232554.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH013I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627967.13e-87PREDICTED: basic leucine zipper 43-like
RefseqXP_013740180.13e-87PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC26e-32BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0D3B1C93e-87A0A0D3B1C9_BRAOL; Uncharacterized protein
STRINGBra006324.1-P4e-83(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.11e-60basic leucine-zipper 3